Lineage for d1zkgb1 (1zkg B:2-75)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. Protein Transcriptional regulator TM1030 [140209] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [140210] (8 PDB entries)
    Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
  8. Domain d1zkgb1: 1zkg B:2-75 [125196]
    Other proteins in same PDB: d1zkga2, d1zkgb2
    automated match to d1zkga1
    complexed with unl

Details for d1zkgb1

PDB Entry: 1zkg (more details), 2.3 Å

PDB Description: Crystal structure of Transcriptional regulator, TETR family (tm1030) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (B:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d1zkgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkgb1 a.4.1.9 (B:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
lqkefenflmknrn

SCOPe Domain Coordinates for d1zkgb1 are not available.

Timeline for d1zkgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zkgb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zkga1, d1zkga2