Lineage for d1zkfb1 (1zkf B:2-165)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806745Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 806746Superfamily b.62.1: Cyclophilin-like [50891] (4 families) (S)
  5. 806747Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 806748Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 806767Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
    Uniprot P05092
  8. 806834Domain d1zkfb1: 1zkf B:2-165 [125193]
    automatically matched to d1ak4a_
    complexed with nit, sin

Details for d1zkfb1

PDB Entry: 1zkf (more details), 2.55 Å

PDB Description: cyrstal structure of human cyclophilin-a in complex with suc-agpf-pna
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOP Domain Sequences for d1zkfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkfb1 b.62.1.1 (B:2-165) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1zkfb1:

Click to download the PDB-style file with coordinates for d1zkfb1.
(The format of our PDB-style files is described here.)

Timeline for d1zkfb1: