Lineage for d1zkfa_ (1zkf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806663Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (136 PDB entries)
    Uniprot P05092
  8. 2806841Domain d1zkfa_: 1zkf A: [125192]
    automated match to d1ak4a_

Details for d1zkfa_

PDB Entry: 1zkf (more details), 2.55 Å

PDB Description: cyrstal structure of human cyclophilin-a in complex with suc-agpf-pna
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1zkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkfa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1zkfa_:

Click to download the PDB-style file with coordinates for d1zkfa_.
(The format of our PDB-style files is described here.)

Timeline for d1zkfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zkfb_