Lineage for d1zkee1 (1zke E:1-79)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640053Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 640116Superfamily a.30.6: HP1531-like [140496] (1 family) (S)
    contains short extra helix in the loop between the two bundle-forming helices
  5. 640117Family a.30.6.1: HP1531-like [140497] (1 protein)
    Small sequence family, specific to Helicobacteraceae
  6. 640118Protein Hypothetical protein HP1531 [140498] (1 species)
  7. 640119Species Helicobacter pylori [TaxId:210] [140499] (1 PDB entry)
  8. 640124Domain d1zkee1: 1zke E:1-79 [125190]
    automatically matched to 1ZKE A:1-79
    complexed with mg

Details for d1zkee1

PDB Entry: 1zke (more details), 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Protein HP1531 of Unknown Function from Helicobacter pylori
PDB Compounds: (E:) Hypothetical protein HP1531

SCOP Domain Sequences for d1zkee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkee1 a.30.6.1 (E:1-79) Hypothetical protein HP1531 {Helicobacter pylori [TaxId: 210]}
mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve
rlkelinalnkikkgllvf

SCOP Domain Coordinates for d1zkee1:

Click to download the PDB-style file with coordinates for d1zkee1.
(The format of our PDB-style files is described here.)

Timeline for d1zkee1: