Lineage for d1zkda1 (1zkd A:2-366)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130478Family c.66.1.52: RPA4359-like [142644] (1 protein)
    Pfam PF02636; DUF185
  6. 2130479Protein Hypothetical protein RPA4359 [142645] (1 species)
  7. 2130480Species Rhodopseudomonas palustris [TaxId:1076] [142646] (1 PDB entry)
    Uniprot Q6N1P6 2-366
  8. 2130481Domain d1zkda1: 1zkd A:2-366 [125184]

Details for d1zkda1

PDB Entry: 1zkd (more details), 2.1 Å

PDB Description: X-Ray structure of the putative protein Q6N1P6 from Rhodopseudomonas palustris at the resolution 2.1 A , Northeast Structural Genomics Consortium target RpR58
PDB Compounds: (A:) duf185

SCOPe Domain Sequences for d1zkda1:

Sequence, based on SEQRES records: (download)

>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]}
idqtalateikrlikaagpmpvwrymelclghpehgyyvtrdplgregdfttspeisqmf
gellglwsasvwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlveinp
vlrqkqqtllagirnihwhdsfedvpegpavilaneyfdvlpihqaikretgwherviei
gasgelvfgvaadpipgfeallpplarlsppgavfewrpdteilkiasrvrdqggaalii
dyghlrsdvgdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtqg
aflkrlgietralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietlv
alsdd

Sequence, based on observed residues (ATOM records): (download)

>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]}
idqtalateikrlikaagpmpvwrymelclghpehgyyvtrfttspeisqmfgellglws
asvwkaadepqtlrlieigpgrgtmmadalralrvlpilyqslsvhlveinpvlrqkqqt
llagirnihwhdsfedvpegpavilaneyfdvlpihqaikretgwhervieigasgelvf
gvaadpipgfeallpplarlsppgavfewrpdteilkiasrvrdqggaaliidyghlrsd
vgdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtqgaflkrlgi
etralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietlvalsdd

SCOPe Domain Coordinates for d1zkda1:

Click to download the PDB-style file with coordinates for d1zkda1.
(The format of our PDB-style files is described here.)

Timeline for d1zkda1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zkdb_