Lineage for d1zkcb1 (1zkc B:280-457)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674688Protein Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain [141505] (1 species)
  7. 674689Species Human (Homo sapiens) [TaxId:9606] [141506] (1 PDB entry)
  8. 674691Domain d1zkcb1: 1zkc B:280-457 [125183]
    automatically matched to 1ZKC A:280-457
    complexed with bme

Details for d1zkcb1

PDB Entry: 1zkc (more details), 1.65 Å

PDB Description: crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase like 2

SCOP Domain Sequences for d1zkcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkcb1 b.62.1.1 (B:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]}
gyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgtifhrsirnfviqggdptgtg
tggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqffitfrscayldkkhtifgr
vvggfdvltamenvesdpktdrpkeeiridattvfvdpyeeadaqiaqerktqlkvap

SCOP Domain Coordinates for d1zkcb1:

Click to download the PDB-style file with coordinates for d1zkcb1.
(The format of our PDB-style files is described here.)

Timeline for d1zkcb1: