Class a: All alpha proteins [46456] (286 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Transcriptional regulator BC5000 [140891] (1 species) |
Species Bacillus cereus [TaxId:1396] [140892] (1 PDB entry) Uniprot Q815X4 78-182 |
Domain d1zk8b2: 1zk8 B:78-183 [125180] Other proteins in same PDB: d1zk8a1, d1zk8b1 automated match to d1zk8a2 |
PDB Entry: 1zk8 (more details), 2.15 Å
SCOPe Domain Sequences for d1zk8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zk8b2 a.121.1.1 (B:78-183) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} krmdeaihalgeayvafvrkhpglyeatflrdeevrkagdgivklclqvlqqyglegena lhatrgfrsichgfasieqqggfglpldldislhvlletfikglre
Timeline for d1zk8b2: