![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins) |
![]() | Protein Transcriptional regulator BC5000 [140891] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [140892] (1 PDB entry) |
![]() | Domain d1zk8b2: 1zk8 B:78-182 [125180] Other proteins in same PDB: d1zk8a1, d1zk8b1 automatically matched to 1ZK8 A:78-182 |
PDB Entry: 1zk8 (more details), 2.15 Å
SCOP Domain Sequences for d1zk8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zk8b2 a.121.1.1 (B:78-182) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} krmdeaihalgeayvafvrkhpglyeatflrdeevrkagdgivklclqvlqqyglegena lhatrgfrsichgfasieqqggfglpldldislhvlletfikglr
Timeline for d1zk8b2: