Lineage for d1zk8b2 (1zk8 B:78-183)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008393Protein Transcriptional regulator BC5000 [140891] (1 species)
  7. 2008394Species Bacillus cereus [TaxId:1396] [140892] (1 PDB entry)
    Uniprot Q815X4 78-182
  8. 2008396Domain d1zk8b2: 1zk8 B:78-183 [125180]
    Other proteins in same PDB: d1zk8a1, d1zk8b1
    automated match to d1zk8a2

Details for d1zk8b2

PDB Entry: 1zk8 (more details), 2.15 Å

PDB Description: Crystal structure of transcriptional regulator from Bacillus cereus ATCC 14579
PDB Compounds: (B:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d1zk8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk8b2 a.121.1.1 (B:78-183) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]}
krmdeaihalgeayvafvrkhpglyeatflrdeevrkagdgivklclqvlqqyglegena
lhatrgfrsichgfasieqqggfglpldldislhvlletfikglre

SCOPe Domain Coordinates for d1zk8b2:

Click to download the PDB-style file with coordinates for d1zk8b2.
(The format of our PDB-style files is described here.)

Timeline for d1zk8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zk8b1