Lineage for d1zk8b1 (1zk8 B:8-77)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981819Protein Transcriptional regulator BC5000 [140191] (1 species)
  7. 1981820Species Bacillus cereus [TaxId:1396] [140192] (1 PDB entry)
    Uniprot Q815X4 6-77
  8. 1981822Domain d1zk8b1: 1zk8 B:8-77 [125179]
    Other proteins in same PDB: d1zk8a2, d1zk8b2
    automated match to d1zk8a1

Details for d1zk8b1

PDB Entry: 1zk8 (more details), 2.15 Å

PDB Description: Crystal structure of transcriptional regulator from Bacillus cereus ATCC 14579
PDB Compounds: (B:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d1zk8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk8b1 a.4.1.9 (B:8-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]}
ltlqkivetaaeiadangvqevtlaslaqtlgvrspslynhvkglqdvrknlgiygikkl
hnrleeaaed

SCOPe Domain Coordinates for d1zk8b1:

Click to download the PDB-style file with coordinates for d1zk8b1.
(The format of our PDB-style files is described here.)

Timeline for d1zk8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zk8b2