Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
Protein Transcriptional regulator BC5000 [140191] (1 species) |
Species Bacillus cereus [TaxId:1396] [140192] (1 PDB entry) Uniprot Q815X4 6-77 |
Domain d1zk8a1: 1zk8 A:6-77 [125177] Other proteins in same PDB: d1zk8a2, d1zk8b2 |
PDB Entry: 1zk8 (more details), 2.15 Å
SCOP Domain Sequences for d1zk8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} igltlqkivetaaeiadangvqevtlaslaqtlgvrspslynhvkglqdvrknlgiygik klhnrleeaaed
Timeline for d1zk8a1: