Lineage for d1zk4a1 (1zk4 A:1-251)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820590Protein R-specific alcohol dehydrogenase [89521] (1 species)
  7. 820591Species Lactobacillus brevis [TaxId:1580] [89522] (8 PDB entries)
  8. 820592Domain d1zk4a1: 1zk4 A:1-251 [125176]
    automatically matched to d1nxqa_
    complexed with ac0, mg, nap

Details for d1zk4a1

PDB Entry: 1zk4 (more details), 1 Å

PDB Description: Structure of R-specific alcohol dehydrogenase (wildtype) from Lactobacillus brevis in complex with acetophenone and NADP
PDB Compounds: (A:) R-specific alcohol dehydrogenase

SCOP Domain Sequences for d1zk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOP Domain Coordinates for d1zk4a1:

Click to download the PDB-style file with coordinates for d1zk4a1.
(The format of our PDB-style files is described here.)

Timeline for d1zk4a1: