SCOP 1.73: Domain d1zk4a1: 1zk4 A:1-251

Lineage for d1zk4a1 (1zk4 A:1-251)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein R-specific alcohol dehydrogenase [89521] (1 species)

7. Species Lactobacillus brevis [TaxId:1580] [89522] (8 PDB entries)

8. Domain d1zk4a1: 1zk4 A:1-251 [125176]
   automatically matched to d1nxqa_
   complexed with ac0, mg, nap

Details for d1zk4a1

PDB Entry: 1zk4, 1 Å

PDB Description: Structure of R-specific alcohol dehydrogenase (wildtype) from Lactobacillus brevis in complex with acetophenone and NADP

PDB Compounds: (A:) R-specific alcohol dehydrogenase

SCOP Domain Sequences for d1zk4a1:

Sequence; same for both SEQRES and ATOM records:

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

Timeline for d1zk4a1:

• d1zk4a1 is new in SCOP 1.73
  
• d1zk4a1 appears in SCOP 1.75
  
• d1zk4a1 appears in the current release, SCOPe 2.08, called d1zk4a_