Lineage for d1zk3b_ (1zk3 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. Protein automated matches [190085] (57 species)
    not a true protein
  7. Species Lactobacillus brevis [TaxId:1580] [186912] (6 PDB entries)
  8. Domain d1zk3b_: 1zk3 B: [125169]
    automated match to d1nxqa_
    complexed with mg; mutant

Details for d1zk3b_

PDB Entry: 1zk3 (more details), 2.2 Å

PDB Description: Triclinic crystal structure of the apo-form of R-specific alcohol dehydrogenase (mutant G37D) from Lactobacillus brevis
PDB Compounds: (B:) R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d1zk3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk3b_ c.2.1.2 (B:) automated matches {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOPe Domain Coordinates for d1zk3b_ are not available.

Timeline for d1zk3b_:

Domains from other chains:
(mouse over for more information)
d1zk3a_, d1zk3c_, d1zk3d_, d1zk3e_, d1zk3f_, d1zk3g_, d1zk3h_