Lineage for d1zk3a_ (1zk3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843252Species Lactobacillus brevis [TaxId:1580] [186912] (6 PDB entries)
  8. 2843258Domain d1zk3a_: 1zk3 A: [125168]
    automated match to d1nxqa_
    complexed with mg; mutant

Details for d1zk3a_

PDB Entry: 1zk3 (more details), 2.2 Å

PDB Description: triclinic crystal structure of the apo-form of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis
PDB Compounds: (A:) R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d1zk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zk3a_ c.2.1.2 (A:) automated matches {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOPe Domain Coordinates for d1zk3a_:

Click to download the PDB-style file with coordinates for d1zk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1zk3a_: