SCOPe 2.08: Domain d1zjya1: 1zjy A:1-251

Lineage for d1zjya1 (1zjy A:1-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein R-specific alcohol dehydrogenase [89521] (1 species)

7. Species Lactobacillus brevis [TaxId:1580] [89522] (11 PDB entries)

8. Domain d1zjya1: 1zjy A:1-251 [125163]
   complexed with mg, nai, ss2; mutant

Details for d1zjya1

PDB Entry: 1zjy, 1.05 Å

PDB Description: structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh

PDB Compounds: (A:) R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d1zjya1:

Sequence; same for both SEQRES and ATOM records:

>d1zjya1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitdrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

Timeline for d1zjya1:

• d1zjya1 first appeared in SCOP 1.73
  
• d1zjya1 appears in SCOPe 2.07