Lineage for d1zjwa1 (1zjw A:339-547)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802937Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2802938Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2803000Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
    automatically mapped to Pfam PF03950
  6. 2803001Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 2803004Species Escherichia coli [TaxId:562] [50721] (17 PDB entries)
  8. 2803007Domain d1zjwa1: 1zjw A:339-547 [125161]
    Other proteins in same PDB: d1zjwa2
    automatically matched to d1euqa1
    protein/RNA complex; complexed with amp, gln, so4

Details for d1zjwa1

PDB Entry: 1zjw (more details), 2.5 Å

PDB Description: Glutaminyl-tRNA synthetase complexed to glutamine and 2'deoxy A76 glutamine tRNA
PDB Compounds: (A:) glutaminyl-tRNA synthetase

SCOPe Domain Sequences for d1zjwa1:

Sequence, based on SEQRES records: (download)

>d1zjwa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1zjwa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

SCOPe Domain Coordinates for d1zjwa1:

Click to download the PDB-style file with coordinates for d1zjwa1.
(The format of our PDB-style files is described here.)

Timeline for d1zjwa1: