Lineage for d1zjpa_ (1zjp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133594Protein automated matches [190178] (2 species)
    not a true protein
  7. 2133601Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)
  8. 2133612Domain d1zjpa_: 1zjp A: [125160]
    automated match to d1lz7a_
    complexed with cl, dr4, hg, mn, udp

Details for d1zjpa_

PDB Entry: 1zjp (more details), 1.59 Å

PDB Description: Crystal Structure of Human Galactosyltransferase (GTB) Complexed with Galactose-grease
PDB Compounds: (A:) ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)

SCOPe Domain Sequences for d1zjpa_:

Sequence, based on SEQRES records: (download)

>d1zjpa_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssrea
ftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d1zjpa_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvleverrflsev
dylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegdfy
ymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspeyl
wdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d1zjpa_:

Click to download the PDB-style file with coordinates for d1zjpa_.
(The format of our PDB-style files is described here.)

Timeline for d1zjpa_: