Lineage for d1zjna2 (1zjn A:92-148)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643336Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643337Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 643338Protein DNA polymerase beta [81579] (2 species)
  7. 643339Species Human (Homo sapiens) [TaxId:9606] [81575] (103 PDB entries)
  8. 643352Domain d1zjna2: 1zjn A:92-148 [125157]
    Other proteins in same PDB: d1zjna1, d1zjna3
    automatically matched to d1bpxa3
    complexed with dgt, mg, na

Details for d1zjna2

PDB Entry: 1zjn (more details), 2.61 Å

PDB Description: human dna polymerase beta complexed with dna containing an a-a mismatched primer terminus with dgtp
PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d1zjna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjna2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d1zjna2:

Click to download the PDB-style file with coordinates for d1zjna2.
(The format of our PDB-style files is described here.)

Timeline for d1zjna2: