Lineage for d1zjma2 (1zjm A:92-148)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. Protein DNA polymerase beta [81579] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)
  8. Domain d1zjma2: 1zjm A:92-148 [125154]
    Other proteins in same PDB: d1zjma1, d1zjma3
    automated match to d1tv9a2
    protein/DNA complex; complexed with na

Details for d1zjma2

PDB Entry: 1zjm (more details), 2.1 Å

PDB Description: Human DNA Polymerase beta complexed with DNA containing an A-A mismatched primer terminus
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1zjma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjma2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d1zjma2 are not available.

Timeline for d1zjma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zjma1, d1zjma3