![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
![]() | Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries) |
![]() | Domain d1zjka3: 1zjk A:366-440 [125151] Other proteins in same PDB: d1zjka1, d1zjka2 automatically matched to d1q3xa2 mutant |
PDB Entry: 1zjk (more details), 2.18 Å
SCOP Domain Sequences for d1zjka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zjka3 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} cgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvceadgfwtsskgek slpvcepvcglsart
Timeline for d1zjka3: