Lineage for d1zjka3 (1zjk A:366-440)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749515Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species)
  7. 749516Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries)
  8. 749519Domain d1zjka3: 1zjk A:366-440 [125151]
    Other proteins in same PDB: d1zjka1, d1zjka2
    automatically matched to d1q3xa2
    mutant

Details for d1zjka3

PDB Entry: 1zjk (more details), 2.18 Å

PDB Description: crystal structure of the zymogen catalytic region of human masp-2
PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOP Domain Sequences for d1zjka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjka3 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]}
cgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvceadgfwtsskgek
slpvcepvcglsart

SCOP Domain Coordinates for d1zjka3:

Click to download the PDB-style file with coordinates for d1zjka3.
(The format of our PDB-style files is described here.)

Timeline for d1zjka3: