Lineage for d1zjka1 (1zjk A:445-686)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056523Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species)
  7. 2056524Species Human (Homo sapiens) [TaxId:9606] [110242] (2 PDB entries)
    Uniprot O00187 366-686
  8. 2056527Domain d1zjka1: 1zjk A:445-686 [125149]
    Other proteins in same PDB: d1zjka2, d1zjka3
    automatically matched to d1q3xa1

Details for d1zjka1

PDB Entry: 1zjk (more details), 2.18 Å

PDB Description: Crystal structure of the zymogen catalytic region of human MASP-2
PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOPe Domain Sequences for d1zjka1:

Sequence, based on SEQRES records: (download)

>d1zjka1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr
lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt
ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg
gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis
df

Sequence, based on observed residues (ATOM records): (download)

>d1zjka1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr
lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt
ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg
gkdscrgdsggalvfldseterwfvggivswgsmnceagqygvytkvinyipwieniisd
f

SCOPe Domain Coordinates for d1zjka1:

Click to download the PDB-style file with coordinates for d1zjka1.
(The format of our PDB-style files is described here.)

Timeline for d1zjka1: