Lineage for d1zjdb_ (1zjd B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259611Protein automated matches [190046] (4 species)
    not a true protein
  7. 2259642Species Human (Homo sapiens) [TaxId:9606] [186911] (4 PDB entries)
  8. 2259652Domain d1zjdb_: 1zjd B: [125148]
    Other proteins in same PDB: d1zjda1
    automated match to d1aapa_

Details for d1zjdb_

PDB Entry: 1zjd (more details), 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with kunitz protease inhibitor domain of protease nexin ii
PDB Compounds: (B:) Kunitz Protease Inhibitory Domain of Protease Nexin II

SCOPe Domain Sequences for d1zjdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjdb_ g.8.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai

SCOPe Domain Coordinates for d1zjdb_:

Click to download the PDB-style file with coordinates for d1zjdb_.
(The format of our PDB-style files is described here.)

Timeline for d1zjdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zjda1