Lineage for d1zjca1 (1zjc A:3-415)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626191Fold e.60: Thermophilic metalloprotease-like [144051] (1 superfamily)
    consists of two domains; d1: alpha/beta (3 layers, a/b/a; parralel beta-sheet, order 2134); d2: pseudo beta-barrel capped by helices
  4. 2626192Superfamily e.60.1: Thermophilic metalloprotease-like [144052] (2 families) (S)
    automatically mapped to Pfam PF02073
  5. 2626193Family e.60.1.1: Thermophilic metalloprotease (M29) [144053] (2 proteins)
    Pfam PF02073
  6. 2626194Protein Aminopeptidase S, AMPS [144056] (1 species)
  7. 2626195Species Staphylococcus aureus [TaxId:1280] [144057] (1 PDB entry)
    Uniprot Q8NVU1 3-415
  8. 2626196Domain d1zjca1: 1zjc A:3-415 [125147]
    complexed with co

Details for d1zjca1

PDB Entry: 1zjc (more details), 1.8 Å

PDB Description: aminopeptidase s from s. aureus
PDB Compounds: (A:) aminopeptidase ampS

SCOPe Domain Sequences for d1zjca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]}
nykeklqqyaellvkvgmnvqpkqpvfirssvetlelthliveeayhcgasdvrvvysdp
tlkrlkfenesvehfanheiksydvearmdyvkrgaanlalisedpdlmdgidsqklqaf
qqqnarafkgymesvqknqfpwvvaafpskawakrvypelsveeayikfidevfdivrid
gndpvenwrqhianlsvyaqklqqknyhalhyvsegtdltvglaknhiwedatsyvngke
qafianipteevftapdrnrvdgyvtnklplsyngtiidqfklmfkdgeiidfsaekgea
vlkdlintdegsrrlgevalvpddspisnrntifyntlfdenaachlaigsayafniqgg
temtveekiasglndsnvhvdfmigssdltiygifedgskelvfengnwastf

SCOPe Domain Coordinates for d1zjca1:

Click to download the PDB-style file with coordinates for d1zjca1.
(The format of our PDB-style files is described here.)

Timeline for d1zjca1: