Lineage for d1zj6a1 (1zj6 A:2-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866732Species Human (Homo sapiens), ARL5A [TaxId:9606] [142218] (1 PDB entry)
    Uniprot Q9Y689 2-178
  8. 2866733Domain d1zj6a1: 1zj6 A:2-178 [125145]
    complexed with g3d, so4

Details for d1zj6a1

PDB Entry: 1zj6 (more details), 2 Å

PDB Description: Crystal structure of human ARL5
PDB Compounds: (A:) ADP-ribosylation factor-like protein 5

SCOPe Domain Sequences for d1zj6a1:

Sequence, based on SEQRES records: (download)

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}
gilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntr
flmwdiggqeslrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkagll
ifankqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrlki

Sequence, based on observed residues (ATOM records): (download)

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}
gilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntr
flmwdiggrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkagllifan
kqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrlki

SCOPe Domain Coordinates for d1zj6a1:

Click to download the PDB-style file with coordinates for d1zj6a1.
(The format of our PDB-style files is described here.)

Timeline for d1zj6a1: