Lineage for d1zj3a1 (1zj3 A:63-345)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706185Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 706186Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families) (S)
  5. 706421Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)
  6. 706475Protein Glycosyltransferase B [75278] (1 species)
    involved in blood group antigen biosynthesis
  7. 706476Species Human (Homo sapiens) [TaxId:9606] [75279] (13 PDB entries)
  8. 706486Domain d1zj3a1: 1zj3 A:63-345 [125144]
    automatically matched to d1lz7a_
    complexed with cl, dr2, hg

Details for d1zj3a1

PDB Entry: 1zj3 (more details), 1.69 Å

PDB Description: crystal structure of human galactosyltransferase (gtb) complexed with h type ii trisaccharide
PDB Compounds: (A:) ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)

SCOP Domain Sequences for d1zj3a1:

Sequence, based on SEQRES records: (download)

>d1zj3a1 c.68.1.9 (A:63-345) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d1zj3a1 c.68.1.9 (A:63-345) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvleverrflse
vdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegdf
yymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspey
lwdqqllgwpavlrklrftavp

SCOP Domain Coordinates for d1zj3a1:

Click to download the PDB-style file with coordinates for d1zj3a1.
(The format of our PDB-style files is described here.)

Timeline for d1zj3a1: