Lineage for d1ziva1 (1ziv A:28-337)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155026Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2155027Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2155031Species Human (Homo sapiens), calpain 9 [TaxId:9606] [142850] (1 PDB entry)
    Uniprot O14815 28-337
  8. 2155032Domain d1ziva1: 1ziv A:28-337 [125139]
    complexed with bme, ca

Details for d1ziva1

PDB Entry: 1ziv (more details), 2.31 Å

PDB Description: Catalytic Domain of Human Calpain-9
PDB Compounds: (A:) Calpain 9

SCOPe Domain Sequences for d1ziva1:

Sequence, based on SEQRES records: (download)

>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]}
sfeqmrqeclqrgtlfedadfpasnsslfyserpqipfvwkrpgeivknpefilggatrt
dicqgelgdcwllaaiasltlnqkalarvipqdqsfgpgyagifhfqfwqhsewldvvid
drlptfrdrlvflhsadhnefwsallekayaklngsyealkggsaieamedftggvaetf
qtkeapenfyeilekalkrgsllgcfidtrsaaeseartpfglikghaysvtgidqvsfr
gqrielirirnpwgqvewngswsdsspewrsvgpaeqkrlchtalddgefwmafkdfkah
fdkveicnlt

Sequence, based on observed residues (ATOM records): (download)

>d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]}
sfeqmrqeclqrgtlfedadfpasnsslfyspqipfvwkrpgeivknpefilggatrtdi
cqgelgdcwllaaiasltlnqkalarvipqdqsfgpgyagifhfqfwqhsewldvviddr
lptfrdrlvflhsadhnefwsallekayaklngsyealkggsaieamedftggvaetfqt
keapenfyeilekalkrgsllgcfidtrsaaeseartpfglikghaysvtgidqvsfrgq
rielirirnpwgqvewngswsdsspewrsvgpaeqkrlchtalddgefwmafkdfkahfd
kveicnlt

SCOPe Domain Coordinates for d1ziva1:

Click to download the PDB-style file with coordinates for d1ziva1.
(The format of our PDB-style files is described here.)

Timeline for d1ziva1: