Lineage for d1ziua1 (1ziu A:1-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913670Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2913697Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
    Uniprot P02928
  8. 2913737Domain d1ziua1: 1ziu A:1-370 [125138]
    complexed with ni
    has additional insertions and/or extensions that are not grouped together

Details for d1ziua1

PDB Entry: 1ziu (more details), 2 Å

PDB Description: crystal structure of nickel-bound engineered maltose binding protein
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d1ziua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ziua1 c.94.1.1 (A:1-370) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwhhdhfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavmalsliynkd
llpnppktweeipaldkelkakgksalmfnlqepeftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafeyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d1ziua1:

Click to download the PDB-style file with coordinates for d1ziua1.
(The format of our PDB-style files is described here.)

Timeline for d1ziua1: