| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
| Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
| Protein Lumazine synthase [52123] (7 species) |
| Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries) beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell |
| Domain d1zisi_: 1zis I: [125136] automated match to d1rvv1_ complexed with ini, po4 |
PDB Entry: 1zis (more details), 2.9 Å
SCOPe Domain Sequences for d1zisi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zisi_ c.16.1.1 (I:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe
Timeline for d1zisi_: