Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
Protein Lumazine synthase [52123] (7 species) |
Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries) beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell |
Domain d1zisg1: 1zis G:1-154 [125134] automatically matched to d1rvv1_ complexed with ini, po4 |
PDB Entry: 1zis (more details), 2.9 Å
SCOP Domain Sequences for d1zisg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zisg1 c.16.1.1 (G:1-154) Lumazine synthase {Bacillus subtilis [TaxId: 1423]} mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten ieqaieragtkagnkgvdcavsaiemanlnrsfe
Timeline for d1zisg1: