Lineage for d1zisf_ (1zis F:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. Protein Lumazine synthase [52123] (7 species)
  7. Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries)
    beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell
  8. Domain d1zisf_: 1zis F: [125133]
    automated match to d1rvv1_
    complexed with ini, po4

Details for d1zisf_

PDB Entry: 1zis (more details), 2.9 Å

PDB Description: recombinant lumazine synthase (hexagonal form)
PDB Compounds: (F:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1zisf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zisf_ c.16.1.1 (F:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOPe Domain Coordinates for d1zisf_ are not available.

Timeline for d1zisf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zisa_, d1zisb_, d1zisc_, d1zisd_, d1zise_, d1zisg_, d1zish_, d1zisi_, d1zisj_