Lineage for d1zisc1 (1zis C:1-154)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691130Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691131Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 691132Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 691133Protein Lumazine synthase [52123] (7 species)
  7. 691160Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries)
    beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell
  8. 691193Domain d1zisc1: 1zis C:1-154 [125130]
    automatically matched to d1rvv1_
    complexed with ini, po4

Details for d1zisc1

PDB Entry: 1zis (more details), 2.9 Å

PDB Description: recombinant lumazine synthase (hexagonal form)
PDB Compounds: (C:) 6,7-dimethyl-8-ribityllumazine synthase

SCOP Domain Sequences for d1zisc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zisc1 c.16.1.1 (C:1-154) Lumazine synthase {Bacillus subtilis [TaxId: 1423]}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOP Domain Coordinates for d1zisc1:

Click to download the PDB-style file with coordinates for d1zisc1.
(The format of our PDB-style files is described here.)

Timeline for d1zisc1: