Lineage for d1zisa_ (1zis A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2113864Protein Lumazine synthase [52123] (7 species)
  7. 2113891Species Bacillus subtilis [TaxId:1423] [52124] (2 PDB entries)
    beta-subunit of the lumazine synthase/riboflavin synthase complex; 60 subunits form an icosahedral shell
  8. 2113922Domain d1zisa_: 1zis A: [125128]
    automated match to d1rvv1_
    complexed with ini, po4

Details for d1zisa_

PDB Entry: 1zis (more details), 2.9 Å

PDB Description: recombinant lumazine synthase (hexagonal form)
PDB Compounds: (A:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1zisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zisa_ c.16.1.1 (A:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]}
mniiqgnlvgtglkigivvgrfndfitskllsgaedallrhgvdtndidvawvpgafeip
faakkmaetkkydaiitlgtvirgatthydyvcneaakgiaqaanttgvpvifgivtten
ieqaieragtkagnkgvdcavsaiemanlnrsfe

SCOPe Domain Coordinates for d1zisa_:

Click to download the PDB-style file with coordinates for d1zisa_.
(The format of our PDB-style files is described here.)

Timeline for d1zisa_: