![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
![]() | Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
![]() | Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries) |
![]() | Domain d1zira1: 1zir A:1001-1084 [125126] automated match to d1a5da1 complexed with act |
PDB Entry: 1zir (more details), 1.36 Å
SCOPe Domain Sequences for d1zira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zira1 b.11.1.1 (A:1001-1084) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]} gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg dypdyqqwmgfsdsvrscrliphs
Timeline for d1zira1: