SCOPe 2.08: Domain d1ziqa1: 1ziq A:1001-1084

Lineage for d1ziqa1 (1ziq A:1001-1084)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)

8. Domain d1ziqa1: 1ziq A:1001-1084 [125124]
   automated match to d1a5da1
   complexed with act, dod

Details for d1ziqa1

PDB Entry: 1ziq, 1.72 Å

PDB Description: Deuterated gammaE crystallin in D2O solvent

PDB Compounds: (A:) Gamma crystallin E

SCOPe Domain Sequences for d1ziqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ziqa1 b.11.1.1 (A:1001-1084) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
dypdyqqwmgfsdsvrscrliphs

Timeline for d1ziqa1:

• d1ziqa1 first appeared in SCOP 1.73
  
• d1ziqa1 appears in SCOPe 2.07