SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ziea2 (1zie A:1085-1172)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038595Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2038596Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2038597Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 protein domains)
  6. 2038598Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2038620Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)
  8. 2038624Domain d1ziea2: 1zie A:1085-1172 [125123]
    automated match to d1a5da2
    complexed with act, dod

Details for d1ziea2

PDB Entry: 1zie (more details), 1.44 Å

PDB Description: Hydrogenated gammaE crystallin in D2O solvent
PDB Compounds: (A:) Gamma crystallin E

SCOPe Domain Sequences for d1ziea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ziea2 b.11.1.1 (A:1085-1172) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
sshririyeredyrgqmveitddcphlqdrfhfsdfhsfhvmegywvlyempnyrgrqyl
lrpgeyrryhdwgamnarvgslrrimdf

SCOPe Domain Coordinates for d1ziea2:

Click to download the PDB-style file with coordinates for d1ziea2.
(The format of our PDB-style files is described here.)

Timeline for d1ziea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ziea1