SCOP 1.73: Domain d1ziea1: 1zie A:1001-1084

Lineage for d1ziea1 (1zie A:1001-1084)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)

8. Domain d1ziea1: 1zie A:1001-1084 [125122]
   automatically matched to d1a5da1
   complexed with act

Details for d1ziea1

PDB Entry: 1zie, 1.44 Å

PDB Description: Hydrogenated gammaE crystallin in D2O solvent

PDB Compounds: (A:) Gamma crystallin E

SCOP Domain Sequences for d1ziea1:

Sequence; same for both SEQRES and ATOM records:

>d1ziea1 b.11.1.1 (A:1001-1084) beta-Crystallin {Rat (Rattus norvegicus), isoform E [TaxId: 10116]}
gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
dypdyqqwmgfsdsvrscrliphs

Timeline for d1ziea1:

• d1ziea1 is new in SCOP 1.73
  
• d1ziea1 appears in SCOP 1.75
  
• d1ziea1 appears in the current release, SCOPe 2.08