Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.338: Oxysterol-binding protein-like [143999] (1 superfamily) core: large meander beta-sheet of 12 strands wrapped around the N-terminal (distorted) alpha-hairpin; some similarity to transmembrane beta-barrel proteins |
Superfamily d.338.1: Oxysterol-binding protein-like [144000] (1 family) automatically mapped to Pfam PF01237 |
Family d.338.1.1: Oxysterol-binding protein [144001] (2 proteins) Pfam PF01237 |
Protein Oxysterol-binding protein homolog 4, KES1 [144002] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144003] (6 PDB entries) Uniprot P35844 2-434! Uniprot P35844 30-434 |
Domain d1zhya2: 1zhy A:2-434 [125113] Other proteins in same PDB: d1zhya3 automated match to d1zhta1 complexed with clr, pb |
PDB Entry: 1zhy (more details), 1.6 Å
SCOPe Domain Sequences for d1zhya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhya2 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sqyasssswtsflksiasfngdlsslsappfilspisltefsqywaehpelflepsfind dnykehclidpevespelarmlavtkwfistlksqycsrneslgsekkplnpflgelfvg kwenkehpefgetvllseqvshhppvtafsifndknkvklqgynqikasftkslmltvkq fghtmldikdesylvtppplhiegilvaspfvelegksyiqsstgllcviefsgrgyfsg kknsfkariykdskdskdkekalytisgqwsgsskiikankkeesrlfydaaripaehln vkpleeqhplesrkawydvagaiklgdfnliaktkteleetqrelrkeeeakgiswqrrw fkdfdysvtpeegalvpekddtflklasalnlstknapsgtlvgdkedrkedlssihwrf qrelwdeekeivl
Timeline for d1zhya2: