SCOPe 2.06: Domain d1zhxa2: 1zhx A:2-434

Lineage for d1zhxa2 (1zhx A:2-434)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.338: Oxysterol-binding protein-like [143999] (1 superfamily)
   core: large meander beta-sheet of 12 strands wrapped around the N-terminal (distorted) alpha-hairpin; some similarity to transmembrane beta-barrel proteins

4. Superfamily d.338.1: Oxysterol-binding protein-like [144000] (1 family)
   automatically mapped to Pfam PF01237

5. Family d.338.1.1: Oxysterol-binding protein [144001] (2 proteins)
   Pfam PF01237

6. Protein Oxysterol-binding protein homolog 4, KES1 [144002] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144003] (6 PDB entries)
   Uniprot P35844 2-434! Uniprot P35844 30-434

8. Domain d1zhxa2: 1zhx A:2-434 [125112]
   Other proteins in same PDB: d1zhxa3
   automated match to d1zhta1
   complexed with hc3

Details for d1zhxa2

PDB Entry: 1zhx, 1.5 Å

PDB Description: Structure of yeast oxysterol binding protein Osh4 in complex with 25-hydroxycholesterol

PDB Compounds: (A:) KES1 protein

SCOPe Domain Sequences for d1zhxa2:

Sequence; same for both SEQRES and ATOM records:

>d1zhxa2 d.338.1.1 (A:2-434) Oxysterol-binding protein homolog 4, KES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqyasssswtsflksiasfngdlsslsappfilspisltefsqywaehpelflepsfind
dnykehclidpevespelarmlavtkwfistlksqycsrneslgsekkplnpflgelfvg
kwenkehpefgetvllseqvshhppvtafsifndknkvklqgynqikasftkslmltvkq
fghtmldikdesylvtppplhiegilvaspfvelegksyiqsstgllcviefsgrgyfsg
kknsfkariykdskdskdkekalytisgqwsgsskiikankkeesrlfydaaripaehln
vkpleeqhplesrkawydvagaiklgdfnliaktkteleetqrelrkeeeakgiswqrrw
fkdfdysvtpeegalvpekddtflklasalnlstknapsgtlvgdkedrkedlssihwrf
qrelwdeekeivl

Timeline for d1zhxa2:

• d1zhxa2 first appeared in SCOP 1.73, called d1zhxa1
  
• d1zhxa2 was called d1zhxa_ in SCOPe 2.05
  
• d1zhxa2 appears in SCOPe 2.07
  
• d1zhxa2 appears in the current release, SCOPe 2.08