![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.8: Atu0741-like [143384] (1 protein) duplication: tandem repeat of two ACT-like domains; contains strand invasion of extra N-terminal strand into the C-terminal domain beta-sheet; dimerizes with the formation of orthogonally packed intersubunit beta-sheets |
![]() | Protein Hypothetical protein Atu0741 [143385] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [143386] (1 PDB entry) Uniprot Q8UHE1 2-61! Uniprot Q8UHE1 62-127 |
![]() | Domain d1zhva2: 1zhv A:62-127 [125110] Other proteins in same PDB: d1zhva3 |
PDB Entry: 1zhv (more details), 1.5 Å
SCOPe Domain Sequences for d1zhva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} gwscfkfqgpfafdetgivlsvisplstngigifvvstfdgdhllvrsndlektadllan aghsll
Timeline for d1zhva2: