SCOPe 2.07: Domain d1zhva1: 1zhv A:2-61

Lineage for d1zhva1 (1zhv A:2-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.8: Atu0741-like [143384] (1 protein)
   duplication: tandem repeat of two ACT-like domains; contains strand invasion of extra N-terminal strand into the C-terminal domain beta-sheet; dimerizes with the formation of orthogonally packed intersubunit beta-sheets

6. Protein Hypothetical protein Atu0741 [143385] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [143386] (1 PDB entry)
   Uniprot Q8UHE1 2-61! Uniprot Q8UHE1 62-127

8. Domain d1zhva1: 1zhv A:2-61 [125109]
   Other proteins in same PDB: d1zhva3

Details for d1zhva1

PDB Entry: 1zhv, 1.5 Å

PDB Description: x-ray crystal structure protein atu0741 from agobacterium tumefaciens. northeast structural genomics consortium target atr8.

PDB Compounds: (A:) hypothetical protein Atu0741

SCOPe Domain Sequences for d1zhva1:

Sequence; same for both SEQRES and ATOM records:

>d1zhva1 d.58.18.8 (A:2-61) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]}
apriklkilngsygiarlsaseaipawadgggfvsitrtddelsivclidripqdvrvdp

Timeline for d1zhva1:

• d1zhva1 first appeared in SCOP 1.73
  
• d1zhva1 appears in SCOPe 2.06
  
• d1zhva1 appears in the current release, SCOPe 2.08