Lineage for d1zhva1 (1zhv A:2-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954192Family d.58.18.8: Atu0741-like [143384] (1 protein)
    duplication: tandem repeat of two ACT-like domains; contains strand invasion of extra N-terminal strand into the C-terminal domain beta-sheet; dimerizes with the formation of orthogonally packed intersubunit beta-sheets
  6. 2954193Protein Hypothetical protein Atu0741 [143385] (1 species)
  7. 2954194Species Agrobacterium tumefaciens [TaxId:358] [143386] (1 PDB entry)
    Uniprot Q8UHE1 2-61! Uniprot Q8UHE1 62-127
  8. 2954195Domain d1zhva1: 1zhv A:2-61 [125109]
    Other proteins in same PDB: d1zhva3

Details for d1zhva1

PDB Entry: 1zhv (more details), 1.5 Å

PDB Description: x-ray crystal structure protein atu0741 from agobacterium tumefaciens. northeast structural genomics consortium target atr8.
PDB Compounds: (A:) hypothetical protein Atu0741

SCOPe Domain Sequences for d1zhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhva1 d.58.18.8 (A:2-61) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]}
apriklkilngsygiarlsaseaipawadgggfvsitrtddelsivclidripqdvrvdp

SCOPe Domain Coordinates for d1zhva1:

Click to download the PDB-style file with coordinates for d1zhva1.
(The format of our PDB-style files is described here.)

Timeline for d1zhva1: