Lineage for d1zhna2 (1zhn A:8-185)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719354Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 719365Species Mouse (Mus musculus) [TaxId:10090] [54457] (6 PDB entries)
  8. 719374Domain d1zhna2: 1zhn A:8-185 [125106]
    Other proteins in same PDB: d1zhna1, d1zhnb1
    automatically matched to d1cd1a2
    complexed with fuc, gol, man, nag, pc6

Details for d1zhna2

PDB Entry: 1zhn (more details), 2.8 Å

PDB Description: crystal structure of mouse cd1d bound to the self ligand phosphatidylcholine
PDB Compounds: (A:) CD1d1 antigen

SCOP Domain Sequences for d1zhna2:

Sequence, based on SEQRES records: (download)

>d1zhna2 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d1zhna2 d.19.1.1 (A:8-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkeieiqlsagcemypgnasesflhvafqgkyvvrfwg
tswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOP Domain Coordinates for d1zhna2:

Click to download the PDB-style file with coordinates for d1zhna2.
(The format of our PDB-style files is described here.)

Timeline for d1zhna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zhna1
View in 3D
Domains from other chains:
(mouse over for more information)
d1zhnb1