Lineage for d1zhna2 (1zhn A:7-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938627Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)
  8. 2938633Domain d1zhna2: 1zhn A:7-185 [125106]
    Other proteins in same PDB: d1zhna1, d1zhnb_
    automated match to d3gmoa1
    complexed with gol, nag, pc6

Details for d1zhna2

PDB Entry: 1zhn (more details), 2.8 Å

PDB Description: crystal structure of mouse cd1d bound to the self ligand phosphatidylcholine
PDB Compounds: (A:) CD1d1 antigen

SCOPe Domain Sequences for d1zhna2:

Sequence, based on SEQRES records: (download)

>d1zhna2 d.19.1.1 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d1zhna2 d.19.1.1 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkeieiqlsagcemypgnasesflhvafqgkyvvrfw
gtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d1zhna2:

Click to download the PDB-style file with coordinates for d1zhna2.
(The format of our PDB-style files is described here.)

Timeline for d1zhna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zhna1
View in 3D
Domains from other chains:
(mouse over for more information)
d1zhnb_