SCOPe 2.03: Domain d1zhna1: 1zhn A:186-279

Lineage for d1zhna1 (1zhn A:186-279)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88616] (11 PDB entries)

8. Domain d1zhna1: 1zhn A:186-279 [125105]
   Other proteins in same PDB: d1zhna2, d1zhnb_
   automatically matched to d1cd1a1
   complexed with gol, nag, pc6

Details for d1zhna1

PDB Entry: 1zhn, 2.8 Å

PDB Description: crystal structure of mouse cd1d bound to the self ligand phosphatidylcholine

PDB Compounds: (A:) CD1d1 antigen

SCOPe Domain Sequences for d1zhna1:

Sequence; same for both SEQRES and ATOM records:

>d1zhna1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Timeline for d1zhna1:

• d1zhna1 first appeared in SCOP 1.73
  
• d1zhna1 appears in SCOPe 2.02
  
• d1zhna1 appears in SCOPe 2.04
  
• d1zhna1 appears in the current release, SCOPe 2.08