Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries) |
Domain d1zhla2: 1zhl A:1-181 [125103] Other proteins in same PDB: d1zhla1, d1zhlb_ automatically matched to d1a1ma2 |
PDB Entry: 1zhl (more details), 1.5 Å
SCOPe Domain Sequences for d1zhla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhla2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq r
Timeline for d1zhla2: