| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
| Domain d1zhla1: 1zhl A:182-276 [125102] Other proteins in same PDB: d1zhla2, d1zhlb1 automatically matched to d1a1ma1 |
PDB Entry: 1zhl (more details), 1.5 Å
SCOP Domain Sequences for d1zhla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhla1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d1zhla1: