Lineage for d1zhka2 (1zhk A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198193Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)
  8. 1198200Domain d1zhka2: 1zhk A:1-181 [125100]
    Other proteins in same PDB: d1zhka1, d1zhkb_
    automatically matched to d1a1ma2

Details for d1zhka2

PDB Entry: 1zhk (more details), 1.6 Å

PDB Description: crystal structure of hla-b*3501 presenting 13-mer ebv antigen lpeplpqgqltay
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d1zhka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1zhka2:

Click to download the PDB-style file with coordinates for d1zhka2.
(The format of our PDB-style files is described here.)

Timeline for d1zhka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zhka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1zhkb_