| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries) |
| Domain d1zhka2: 1zhk A:1-181 [125100] Other proteins in same PDB: d1zhka1, d1zhkb_ automatically matched to d1a1ma2 |
PDB Entry: 1zhk (more details), 1.6 Å
SCOPe Domain Sequences for d1zhka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r
Timeline for d1zhka2: