SCOPe 2.08: Domain d1zhib1: 1zhi B:487-611

Lineage for d1zhib1 (1zhi B:487-611)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.339: ORC1-binding domain [144004] (1 superfamily)
   complex fold, composed of an alpha hairpin, meander beta-sheet and a five-stranded barrel of unusual topology

4. Superfamily d.339.1: ORC1-binding domain [144005] (1 family)
   automatically mapped to Pfam PF11603

5. Family d.339.1.1: ORC1-binding domain [144006] (1 protein)

6. Protein Regulatory protein SIR1 [144007] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144008] (3 PDB entries)
   Uniprot P21691 484-611! Uniprot P21691 485-613! Uniprot P21691 487-611

8. Domain d1zhib1: 1zhi B:487-611 [125097]
   Other proteins in same PDB: d1zhia_

Details for d1zhib1

PDB Entry: 1zhi, 2.7 Å

PDB Description: complex of the s. cerevisiae orc1 and sir1 interacting domains

PDB Compounds: (B:) Regulatory protein SIR1

SCOPe Domain Sequences for d1zhib1:

Sequence; same for both SEQRES and ATOM records:

>d1zhib1 d.339.1.1 (B:487-611) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqdp
iplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlascvpillddqtvq
ylydd

Timeline for d1zhib1:

• d1zhib1 first appeared in SCOP 1.73
  
• d1zhib1 appears in SCOPe 2.07