Lineage for d1zhia_ (1zhi A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047481Superfamily b.34.12: BAH domain [82061] (2 families) (S)
  5. 2047482Family b.34.12.1: BAH domain [82062] (2 protein domains)
  6. 2047494Protein Origin-recognition complex protein 120kDa subunit, Orc1p [82063] (1 species)
  7. 2047495Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82064] (3 PDB entries)
  8. 2047499Domain d1zhia_: 1zhi A: [125096]
    Other proteins in same PDB: d1zhib1
    automated match to d1m4zb_

Details for d1zhia_

PDB Entry: 1zhi (more details), 2.7 Å

PDB Description: Complex of the S. cerevisiae Orc1 and Sir1 interacting domains
PDB Compounds: (A:) Origin recognition complex subunit 1

SCOPe Domain Sequences for d1zhia_:

Sequence, based on SEQRES records: (download)

>d1zhia_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gweiittdeqgniidggqkrlrrrgaktehylkrssdgiklgrgdsvvmhneaagtysvy
miqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetank
nelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdini
edvkayikkvepreaqeylkdltlp

Sequence, based on observed residues (ATOM records): (download)

>d1zhia_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gweiittdeqgniidggtehylkrssdgiklgrgdsvvmhneaagtysvymiqelrlntl
nnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetanknelyltaela
elqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdiniedvkayikkv
epreaqeylkdltlp

SCOPe Domain Coordinates for d1zhia_:

Click to download the PDB-style file with coordinates for d1zhia_.
(The format of our PDB-style files is described here.)

Timeline for d1zhia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zhib1